Iron Mountain Labz ships from within the United States. All orders are sent in discreet packaging to protect the contents and ensure the privacy of the buyer.

PNC-27

$303.65

Enjoy 15% OFF this product –  sign up for our newsletter today!
📈 653+ People viewed this in the last 7 days
Layer_1-7

Easy Secure Payment

Layer_1-8

Online Support

Layer_1-9

Fast Shipping

Description

Disclaimer: All Iron Mountain Labz products are only intended for laboratory research use and are not approved for use outside of controlled research settings. All referenced research was conducted under IRB/IACUC/AWA-compliant protocols. This compound is not approved for human or veterinary use.

Overview of PNC-27 10mg

PNC-27 is a synthetic 32-residue chimeric peptide constructed from two functionally distinct domains: residues 12–26 of the HDM-2 binding domain of the tumor suppressor protein p53, covalently linked to a membrane residency peptide (MRP) leader sequence — a cell-penetrating sequence originally characterized for its capacity to facilitate trans-membrane and trans-nuclear peptide transport. 

This dual-domain architecture distinguishes PNC-27 from conventional p53-derived research peptides by enabling direct plasma membrane interaction in addition to intracellular target engagement in preclinical models.

The structural combination of the p53-derived HDM-2 binding segment and the MRP leader sequence was found in preclinical investigations to be essential for the compound’s observed membrane-active properties, as neither domain alone — nor both as non-conjugated separate peptides — reproduced the investigational activity profile of the intact chimeric structure. 

This structural dependency has made PNC-27 a well-characterized investigational tool for chimeric peptide design research and membrane-targeting oncology studies.

Section Details
CAS Number 1159861-00-3
Molar Mass 4031.72 g/mol
Chemical Formula C₁₈₈H₂₉₃N₅₃O₄₄S
Sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Synonyms p53(12–26)–penetratin/MRP chimera, HDM-2–targeted lytic peptide, p53-derived anticancer peptide
Ingredients / Composition PNC-27 compound as key component with a purity of 99%+
Shelf Life 2 years
Storage Instructions Store as lyophilized powder at –20°C or below, protected from light and moisture
Disclaimer PNC-27 10mg is not approved for use outside of controlled laboratory research settings. It is legal for research purposes only.

Why Buy PNC-27 10mg from Iron Mountain Labz?

Researchers prefer Iron Mountain Labz for buying PNC-27 10mg due to the following reasons:

At Iron Mountain Labz, PNC-27 10mg is tested with HPLC and confirmed at ≥99%+ purity. The assay result of this product meets research-grade standards for investigational use. A Certificate of Analysis (COA) is also provided for verification.

Frequently Asked Questions

What is PNC-27 and what is it used for in research? 

PNC-27 is a synthetic 32-residue chimeric peptide combining a p53-derived HDM-2 binding domain with a membrane residency peptide (MRP) leader sequence. It is investigated in preclinical oncology research models for its membrane-active properties, selective tumor cell lysis activity, and HDM-2 surface expression characterization in preclinical models.

How does PNC-27 interact with HDM-2 at the molecular level? 

Preclinical data indicate that PNC-27 binds to HDM-2 protein expressed on the plasma membrane of tumor cells, forming 1:1 complexes that assemble into ring-shaped transmembrane pore structures. This pore formation has been associated with rapid tumor cell necrosis in research models, while untransformed normal cells have not exhibited equivalent membrane disruption under investigational conditions.

What preclinical research has been conducted on PNC-27? 

PNC-27 has been investigated across solid tumor cell lines and non-solid tissue leukemia models including K562, U937, OCI-AML3, and HL60 cell lines. Preclinical findings document near-complete tumor cell lysis via LDH release assays, mitochondrial membrane localization confirmed by gold immunolabeling studies, and p53-independent cytotoxic activity in p53-homozygously deleted research models.

How should PNC-27 be stored and handled in a laboratory setting? 

PNC-27 10mg should be stored as lyophilized powder at –20°C or below, protected from light and moisture. Reconstitution is recommended under sterile conditions using research-grade aqueous buffer. Repeated freeze-thaw cycling should be avoided to preserve peptide integrity. Standard laboratory PPE — gloves, eyewear, and lab coat — is recommended during all handling procedures. Researchers are advised to consult the Safety Data Sheet (SDS) prior to use.

Is PNC-27 approved for human or clinical use? 

PNC-27 is not approved by the FDA or any regulatory authority for human or clinical use. It is strictly an investigational research compound intended for controlled laboratory settings only. All Iron Mountain Labz products are sold for research purposes exclusively and are not approved for administration to humans or animals.

Additional information

Form

PNC-27

Dose

10mg

Reviews

There are no reviews yet.

Be the first to review “PNC-27”

Your email address will not be published. Required fields are marked *

Sterile-Oil

Sterile Oil Injectable

If you experience injection pain, consider purchasing sterile oil. It helps ease discomfort by thinning the compound, making injections smoother.

Price : $18.00

Dose : 64mg per ml/10ml/640mg